| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATF4 |
|---|
| Clone | 2B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATF4 Antibody (2B3) from Novus Biologicals is a mouse monoclonal antibody to ATF4. This antibody reacts with human, mouse. The ATF4 Antibody (2B3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | ATF4 (NP_001666.2 171 a.a. - 270 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA |
|---|
| Other Names | Activating transcription factor 4, activating transcription factor 4 (tax-responsive enhancer element B67), cAMP-dependent transcription factor ATF-4, cAMP-responsive element-binding protein 2, CREB-2DNA-binding protein TAXREB67, cyclic AMP-dependent transcription factor ATF-4, Cyclic AMP-responsive element-binding protein 2, TaxREB67, TAXREB67CREB2cAMP response element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TXREB |
|---|
| Gene, Accession # | ATF4, Gene ID: 468, Accession: P18848, SwissProt: P18848 |
|---|
| Catalog # | H00000468-M01 |
|---|
| Price | |
|---|
| Order / More Info | ATF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20651984, 22215650, 22498744, 23223004, 23519122, 24161693 |
|---|
| 产品资料 |
|
|