| 产品详情 |
| Edit |   |
| Antigenic Specificity | RUVBL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RUVBL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUVBL2. This antibody reacts with human. The RUVBL2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RUVBL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR |
| Other Names | 48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,48 kDa TBP-interacting protein, ECP51TIP49B, erythrocyte cytosolic protein, 51-KD, INO80 complex subunit J, INO80JTAP54-beta, Repressing pontin 52, REPTIN, Reptin 52, Reptin52, RuvB (E coli homolog)-like 2, ruvB-like 2, RuvB-like 2 (E. coli), RVB2, TBP-interacting protein, 48-KD, TIH2, TIP48ECP-51, TIP49b, TIP60-associated protein 54-beta |
| Gene, Accession # | RUVBL2, Gene ID: 10856 |
| Catalog # | NBP2-57593 |
| Price | |
| Order / More Info | RUVBL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|