| 产品详情 |
| Edit |   |
| Antigenic Specificity | RUVBL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RUVBL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUVBL1. This antibody reacts with human. The RUVBL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human RUVBL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV |
| Other Names | 49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,49 kDa TBP-interacting protein, ECP54, INO80 complex subunit H, INO80HTIP49A, NMP 238, NMP238ECP-54, Nuclear matrix protein 238, PONTIN, Pontin 52, Pontin52, RuvB (E coli homolog)-like 1, ruvB-like 1, RuvB-like 1 (E. coli), RVB1, TATA binding protein interacting protein 49 kDa, TIH1, TIP49a, TIP49TAP54-alpha, TIP60-associated protein 54-alpha |
| Gene, Accession # | RUVBL1, Gene ID: 8607 |
| Catalog # | NBP1-84914 |
| Price | |
| Order / More Info | RUVBL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23443080 |
| 产品资料 |
|
|