| 产品详情 |
| Edit |   |
| Antigenic Specificity | HYPE |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HYPE Antibody from Novus Biologicals is a rabbit polyclonal antibody to HYPE. This antibody reacts with human. The HYPE Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human HYPE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD |
| Other Names | AMPylator FICD, EC 2.7.7.n1, FIC domain containing, FIC domain-containing protein, fic S-phase protein cell division homolog, HIP-13, HIP13UNQ3041, huntingtin interacting protein 13, Huntingtin interacting protein E, huntingtin interactor protein E, Huntingtin yeast partner E, Huntingtin-interacting protein 13, Huntingtin-interacting protein E, HYPEadenosine monophosphate-protein transferase FICD, MGC5623 |
| Gene, Accession # | FICD, Gene ID: 11153 |
| Catalog # | NBP2-58855 |
| Price | |
| Order / More Info | HYPE Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|