| 产品详情 |
| Edit |   |
| Antigenic Specificity | hydroxysteroid (17-beta) dehydrogenase 11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, monkey |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The hydroxysteroid (17-beta) dehydrogenase 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to hydroxysteroid (17-beta) dehydrogenase 11. This antibody reacts with human, monkey. The hydroxysteroid (17-beta) dehydrogenase 11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to HSD17B11 (hydroxysteroid (17-beta) dehydrogenase 11) The peptide sequence was selected from the N terminal of HSD17B11. Peptide sequence TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG. |
| Other Names | 17betaHSD11, 17betaHSDXI, 17-beta-hydroxysteroid dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, 17-beta-hydroxysteroid dehydrogenase XI, 17bHSD11, CTCL-associated antigen HD-CL-03, dehydrogenase/reductase (SDR family) member 8, DHRS8, EC 1.1.1, EC 1.1.1.62, hydroxysteroid (17-beta) dehydrogenase 11, member 2,17-beta-HSD 11, PAN1BRETSDR2,17-BETA-HSD11, retSDR2, RetSDR2,17-BETA-HSDXI, SDR16C2,17BHSD11, T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI |
| Gene, Accession # | HSD17B11, Gene ID: 51170, Accession: Q8NBQ5, SwissProt: Q8NBQ5 |
| Catalog # | NBP1-57081-20ul |
| Price | |
| Order / More Info | hydroxysteroid (17-beta) dehydrogenase 11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|