| Edit |   |
| Antigenic Specificity | PCNP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCNP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCNP. This antibody reacts with mouse. The PCNP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human PcnpThe immunogen for this antibody is Pcnp. Peptide sequence AFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKL. |
| Other Names | DKFZp781I24156, PEST proteolytic signal containing nuclear protein, PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein |
| Gene, Accession # | PCNP, Gene ID: 57092, Accession: NP_001019793 |
| Catalog # | NBP1-79669 |
| Price | |
| Order / More Info | PCNP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |