| 产品详情 |
| Edit |   |
| Antigenic Specificity | OATP1B3/SLCO1B3/OATP8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OATP1B3/SLCO1B3/OATP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OATP1B3/SLCO1B3/OATP8. This antibody reacts with human. The OATP1B3/SLCO1B3/OATP8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human OATP1B3/SLCO1B3/OATP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| Other Names | Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3 |
| Gene, Accession # | SLCO1B3, Gene ID: 28234, Accession: Q9NPD5, SwissProt: Q9NPD5 |
| Catalog # | NBP1-80980 |
| Price | |
| Order / More Info | OATP1B3/SLCO1B3/OATP8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 21552413, 25625007 |
| 产品资料 |
|
|