| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OAS3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OAS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OAS3. This antibody reacts with human. The OAS3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human OAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCP |
|---|
| Other Names | (2-5')oligo(A) synthase 3,2'-5'oligoadenylate synthetase p100, 2-5A synthase 3, 2'-5'-oligoadenylate synthase 3, 2'-5'-oligoadenylate synthetase 3, 100kDa, P/OKcl.4, p100 OAS |
|---|
| Gene, Accession # | OAS3, Gene ID: 4940 |
|---|
| Catalog # | NBP1-85841 |
|---|
| Price | |
|---|
| Order / More Info | OAS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|