| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRA2B |
|---|
| Clone | 7A1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRA2B Antibody (7A1) from Novus Biologicals is a mouse monoclonal antibody to TRA2B. This antibody reacts with human. The TRA2B Antibody (7A1) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | SFRS10 (NP_004584, 120 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP |
|---|
| Other Names | DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-beta, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta |
|---|
| Gene, Accession # | TRA2B, Gene ID: 6434, Accession: NP_004584, SwissProt: NP_004584 |
|---|
| Catalog # | H00006434-M01 |
|---|
| Price | |
|---|
| Order / More Info | TRA2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18649067 |
|---|
| 产品资料 |
|
|