| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMARCD1. This antibody reacts with human, mouse, rat. The SMARCD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SMARCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK |
|---|
| Other Names | BAF60Amammalian chromatin remodeling complex BRG1-associated factor 60A, BRG1-associated factor 60A, chromatin remodeling complex BAF60A subunit, CRACD1, Rsc6p, subfamily d, member 1, SWI/SNF complex 60 kDa subunit, SWI/SNF complex 60 kDa subunit A, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 1,60 kDa BRG-1/Brm-associated factor subunit A, Swp73-like protein |
|---|
| Gene, Accession # | SMARCD1, Gene ID: 6602 |
|---|
| Catalog # | NBP1-88719 |
|---|
| Price | |
|---|
| Order / More Info | SMARCD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22361696 |
|---|
| 产品资料 |
|
|