| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCA5/SNF2H |
|---|
| Clone | 3F4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCA5/SNF2H Antibody (3F4) from Novus Biologicals is a mouse monoclonal antibody to SMARCA5/SNF2H. This antibody reacts with human. The SMARCA5/SNF2H Antibody (3F4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SMARCA5 (NP_003592, 59 a.a. - 147 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE |
|---|
| Other Names | EC 3.6.1, EC 3.6.4.-, hISWI, hSNF2HSWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5, ISWI, SNF2Hsucrose nonfermenting-like 5, subfamily a, member 5, Sucrose nonfermenting protein 2 homolog, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 5, WCRF135 |
|---|
| Gene, Accession # | SMARCA5, Gene ID: 8467, Accession: NP_003592, SwissProt: NP_003592 |
|---|
| Catalog # | H00008467-M02 |
|---|
| Price | |
|---|
| Order / More Info | SMARCA5/SNF2H Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|