| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCA6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMARCA6. This antibody reacts with human. The SMARCA6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SMARCA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV |
|---|
| Other Names | EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6 |
|---|
| Gene, Accession # | HELLS, Gene ID: 3070, Accession: Q9NRZ9, SwissProt: Q9NRZ9 |
|---|
| Catalog # | NBP2-38986 |
|---|
| Price | |
|---|
| Order / More Info | SMARCA6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|