| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMARCA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMARCA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMARCA1. This antibody reacts with human. The SMARCA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SMARCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ |
|---|
| Other Names | ATP-dependent helicase SMARCA1, DKFZp686D1623, EC 3.6.1, EC 3.6.4.-, FLJ41547, global transcription activator homologous sequence, Nucleosome-remodeling factor subunit SNF2L, NURF140, probable global transcription activator SNF2L1, SNF2L, SNF2L1ISWI, SNF2LB, SNF2-like 1, SNF2LT, subfamily a, member 1, sucrose nonfermenting 2-like protein 1, SWI, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1, SWI2 |
|---|
| Gene, Accession # | SMARCA1, Gene ID: 6594 |
|---|
| Catalog # | NBP2-56279 |
|---|
| Price | |
|---|
| Order / More Info | SMARCA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|