| Edit |   |
| Antigenic Specificity | SMAP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SMAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMAP. This antibody reacts with human. The SMAP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SMAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESDSESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS |
| Other Names | small acidic protein, chromosome 11 open reading frame 58, SMAP |
| Gene, Accession # | C11ORF58, Gene ID: 10944 |
| Catalog # | NBP2-57456 |
| Price | |
| Order / More Info | SMAP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |