| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HBQ1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HBQ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HBQ1. This antibody reacts with human. The HBQ1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HBQ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RHYPGDFSPALQASLDKFLSHVISALVSEYR |
|---|
| Other Names | hemoglobin subunit theta-1, Hemoglobin theta-1 chain, hemoglobin, theta 1, theta-1-globin |
|---|
| Gene, Accession # | HBQ1, Gene ID: 3049, Accession: P09105, SwissProt: P09105 |
|---|
| Catalog # | NBP2-38960 |
|---|
| Price | |
|---|
| Order / More Info | HBQ1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|