| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMC3. This antibody reacts with human. The SMC3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human SMC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQM |
|---|
| Other Names | Bamacan, BAMSMC protein 3, Basement membrane-associated chondroitin proteoglycan, BMH, Chondroitin sulfate proteoglycan 6, chondroitin sulfate proteoglycan 6 (bamacan), Chromosome-associated polypeptide, CSPG6structural maintenance of chromosomes protein 3, hCAP, HCAPbamacan, SMC-3, SMC3L1CDLS3, structural maintenance of chromosomes 3 |
|---|
| Gene, Accession # | SMC3, Gene ID: 9126 |
|---|
| Catalog # | NBP2-58330 |
|---|
| Price | |
|---|
| Order / More Info | SMC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|