| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SMC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SMC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMC2. This antibody reacts with human. The SMC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE. |
|---|
| Other Names | CAP-E, CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast), Chromosome-associated protein E, FLJ10093, hCAP-EXCAP-E homolog, SMC protein 2, SMC-2, SMC2 (structural maintenance of chromosomes 2, yeast)-like 1, SMC2 structural maintenance of chromosomes 2-like 1, SMC2L1, structural maintenance of chromosomes (SMC) family member, structural maintenance of chromosomes 2, structural maintenance of chromosomes protein 2 |
|---|
| Gene, Accession # | SMC2, Gene ID: 10592 |
|---|
| Catalog # | NBP1-52932-20ul |
|---|
| Price | |
|---|
| Order / More Info | SMC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|