| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPT Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPT. This antibody reacts with human. The GPT Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE |
|---|
| Other Names | AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1 |
|---|
| Gene, Accession # | GPT, Gene ID: 2875 |
|---|
| Catalog # | NBP1-89110 |
|---|
| Price | |
|---|
| Order / More Info | GPT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|