| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPSM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPSM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPSM2. This antibody reacts with human. The GPSM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA. |
|---|
| Other Names | deafness, autosomal recessive 82, DFNB82, G-protein signaling modulator 2, G-protein signalling modulator 2 (AGS3-like, C. elegans), G-protein-signaling modulator 2, LGNPins, Mosaic protein LGN, PINS |
|---|
| Gene, Accession # | GPSM2, Gene ID: 29899, Accession: P81274, SwissProt: P81274 |
|---|
| Catalog # | NBP1-53125 |
|---|
| Price | |
|---|
| Order / More Info | GPSM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|