| 产品详情 |
| Edit |   |
| Antigenic Specificity | GPR177/WLS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPR177/WLS Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR177/WLS. This antibody reacts with human. The GPR177/WLS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GPR177/WLS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD |
| Other Names | C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless homolog (Drosophila) |
| Gene, Accession # | WLS, Gene ID: 79971 |
| Catalog # | NBP2-57299 |
| Price | |
| Order / More Info | GPR177/WLS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|