| Edit |   |
| Antigenic Specificity | G protein beta 4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The G protein beta 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to G protein beta 4. This antibody reacts with human. The G protein beta 4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY. |
| Other Names | G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4 |
| Gene, Accession # | GNB4, Gene ID: 59345, Accession: NP_067642, SwissProt: NP_067642 |
| Catalog # | NBP1-79681 |
| Price | |
| Order / More Info | G protein beta 4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |