| Edit |   |
|---|
| Antigenic Specificity | THAP5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The THAP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to THAP5. This antibody reacts with human. The THAP5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to THAP5(THAP domain containing 5) The peptide sequence was selected from the middle region of THAP5. Peptide sequence TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF. |
|---|
| Other Names | DKFZp313O1132, THAP domain containing 5, THAP domain-containing protein 5 |
|---|
| Gene, Accession # | THAP5, Gene ID: 168451, Accession: Q7Z6K1, SwissProt: Q7Z6K1 |
|---|
| Catalog # | NBP1-56750 |
|---|
| Price | |
|---|
| Order / More Info | THAP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|