| 产品详情 |
| Edit |   |
| Antigenic Specificity | CIZ1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CIZ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CIZ1. This antibody reacts with human, mouse. The CIZ1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse CIZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL |
| Other Names | CDKN1A interacting zinc finger protein 1, CDKN1A-interacting zinc finger protein 1, cip1-interacting zinc finger protein, LSFR1ZNF356Nuclear protein NP94, NP94, Zinc finger protein 356 |
| Gene, Accession # | CIZ1, Gene ID: 25792, Accession: Q9ULV3, SwissProt: Q9ULV3 |
| Catalog # | NBP2-33890 |
| Price | |
| Order / More Info | CIZ1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27163549 |
| 产品资料 |
|
|