| Edit |   |
|---|
| Antigenic Specificity | MISP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MISP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MISP1. This antibody reacts with human. The MISP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C19ORF21 The peptide sequence was selected from the C terminal of C19ORF21. Peptide sequence RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS. |
|---|
| Other Names | chromosome 19 open reading frame 21, DKFZp686H18209, hypothetical protein LOC126353 |
|---|
| Gene, Accession # | MISP, Gene ID: 126353, Accession: Q8IVT2, SwissProt: Q8IVT2 |
|---|
| Catalog # | NBP1-56743 |
|---|
| Price | |
|---|
| Order / More Info | MISP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|