| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CIRBP |
|---|
| Clone | 1C9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CIRBP Antibody (1C9) from Novus Biologicals is a mouse monoclonal antibody to CIRBP. This antibody reacts with human. The CIRBP Antibody (1C9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CIRBP (NP_001271.1, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRS |
|---|
| Other Names | A18 hnRNP, A18HNRNP, CIRPcold-inducible RNA-binding protein, cold inducible RNA binding protein, cold inducible RNA-binding protein, glycine-rich RNA binding protein, Glycine-rich RNA-binding protein CIRP |
|---|
| Gene, Accession # | CIRBP, Gene ID: 1153, Accession: NP_001271, SwissProt: NP_001271 |
|---|
| Catalog # | H00001153-M03 |
|---|
| Price | |
|---|
| Order / More Info | CIRBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|