| Edit |   |
|---|
| Antigenic Specificity | CACNG6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACNG6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACNG6. This antibody reacts with human. The CACNG6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CACNG6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTK |
|---|
| Other Names | calcium channel, voltage-dependent, gamma subunit 6, Neuronal voltage-gated calcium channel gamma-6 subunit, voltage-dependent calcium channel gamma-6 subunit |
|---|
| Gene, Accession # | CACNG6, Gene ID: 59285 |
|---|
| Catalog # | NBP2-56816 |
|---|
| Price | |
|---|
| Order / More Info | CACNG6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|