| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PMPCA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PMPCA Antibody from Novus Biologicals is a rabbit polyclonal antibody to PMPCA. This antibody reacts with human. The PMPCA Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PMPCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVDTVELERAKTQLTSMLMMNLES |
|---|
| Other Names | Alpha-MPPMGC104197, EC 3.4.24.64, inositol polyphosphate-5-phosphatase, 72 kD, INPP5E, KIAA0123FLJ26258, mitochondrial matrix processing protease, alpha subunit, mitochondrial-processing peptidase subunit alpha, MPPA, P-55, peptidase (mitochondrial processing) alpha |
|---|
| Gene, Accession # | PMPCA, Gene ID: 23203 |
|---|
| Catalog # | NBP2-57169 |
|---|
| Price | |
|---|
| Order / More Info | PMPCA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|