| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ICAP-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ICAP-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ICAP-1. This antibody reacts with human. The ICAP-1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT |
|---|
| Other Names | bodenin, DKFZp686K08158, ICAP-1, ICAP-1alpha, ICAP-1B, ICAP1ICAP1AICAP1BICAP-1A, integrin beta 1 binding protein 1, integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta |
|---|
| Gene, Accession # | ITGB1BP1, Gene ID: 9270 |
|---|
| Catalog # | NBP2-68856 |
|---|
| Price | |
|---|
| Order / More Info | ICAP-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|