| Edit |   |
|---|
| Antigenic Specificity | UNCX |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UNCX Antibody from Novus Biologicals is a rabbit polyclonal antibody to UNCX. This antibody reacts with human. The UNCX Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human UNCX. Peptide sequence LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKA. |
|---|
| Other Names | homeobox protein unc-4 homolog, homeobox protein Uncx4.1, UNC homeobox |
|---|
| Gene, Accession # | UNCX, Gene ID: 340260, Accession: NP_001073930, SwissProt: NP_001073930 |
|---|
| Catalog # | NBP1-91315-20ul |
|---|
| Price | |
|---|
| Order / More Info | UNCX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|