| Edit |   |
|---|
| Antigenic Specificity | UNC5H3/UNC5C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UNC5H3/UNC5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to UNC5H3/UNC5C. This antibody reacts with human. The UNC5H3/UNC5C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C (NP_003719). Peptide sequence WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE. |
|---|
| Other Names | netrin receptor UNC5C, Protein unc-5 homolog 3, Protein unc-5 homolog C, unc-5 homolog 3, unc-5 homolog C (C. elegans), UNC5H3unc5 (C.elegans homolog) c |
|---|
| Gene, Accession # | UNC5C, Gene ID: 8633, Accession: O95185, SwissProt: O95185 |
|---|
| Catalog # | NBP1-69283 |
|---|
| Price | |
|---|
| Order / More Info | UNC5H3/UNC5C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|