| Edit |   |
| Antigenic Specificity | WIF-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WIF-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WIF-1. This antibody reacts with human. The WIF-1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human WIF1The immunogen for this antibody is WIF1. Peptide sequence RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN. |
| Other Names | WIF-1, WNT inhibitory factor 1 |
| Gene, Accession # | WIF1, Gene ID: 11197, Accession: NP_009122, SwissProt: NP_009122 |
| Catalog # | NBP1-79491 |
| Price | |
| Order / More Info | WIF-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |