| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UQCRQ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UQCRQ Antibody from Novus Biologicals is a rabbit polyclonal antibody to UQCRQ. This antibody reacts with human. The UQCRQ Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UQCRQ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR |
|---|
| Other Names | complex III subunit 8, cytochrome b-c1 complex subunit 8, low molecular mass ubiquinone-binding protein (9.5kD), QPC, ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, UQCR7 |
|---|
| Gene, Accession # | UQCRQ, Gene ID: 27089 |
|---|
| Catalog # | NBP1-92563 |
|---|
| Price | |
|---|
| Order / More Info | UQCRQ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25605331 |
|---|
| 产品资料 |
|
|