| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UQCRH |
|---|
| Clone | 1D7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UQCRH Antibody (1D7) from Novus Biologicals is a mouse monoclonal antibody to UQCRH. This antibody reacts with human. The UQCRH Antibody (1D7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | UQCRH (AAH15177, 1 a.a. - 91 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK |
|---|
| Other Names | Complex III subunit 6, Complex III subunit VIII, cytochrome b-c1 complex subunit 6, mitochondrial, Cytochrome c1 non-heme 11 kDa protein, MGC111572, Mitochondrial hinge protein, QCR6, Ubiquinol-cytochrome c reductase complex 11 kDa protein, ubiquinol-cytochrome c reductase hinge protein, ubiquinol-cytochrome c reductase, complex III subunit VIII, UQCR8 |
|---|
| Gene, Accession # | UQCRH, Gene ID: 7388, Accession: AAH15177, SwissProt: AAH15177 |
|---|
| Catalog # | H00007388-M02 |
|---|
| Price | |
|---|
| Order / More Info | UQCRH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|