| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UQCRFS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in the literature (PMID:25605331). Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UQCRFS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UQCRFS1. This antibody reacts with human, rat. The UQCRFS1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat UQCRFS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV |
|---|
| Other Names | Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5 |
|---|
| Gene, Accession # | UQCRFS1, Gene ID: 7386 |
|---|
| Catalog # | NBP1-87826 |
|---|
| Price | |
|---|
| Order / More Info | UQCRFS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25605331, 28967163 |
|---|
| 产品资料 |
|
|