| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPECC1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPECC1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPECC1L. This antibody reacts with human. The SPECC1L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SPECC1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT |
|---|
| Other Names | Cytokinesis And Spindle Organization A, Cytospin A, CYTSA, GBBB2, KIAA0376, OBLFC1, Renal Carcinoma Antigen NY-REN-22, SPECC1-Like, SPECC1-Like Protein, Sperm Antigen With Calponin Homology And Coiled-Coil Domains 1-Like |
|---|
| Gene, Accession # | SPECC1L, Gene ID: 23384 |
|---|
| Catalog # | NBP2-49640 |
|---|
| Price | |
|---|
| Order / More Info | SPECC1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|