| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPDYE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPDYE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPDYE1. This antibody reacts with human. The SPDYE1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SPDYE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM |
|---|
| Other Names | Putative WBSCR19-Like Protein 6, Ringo1, SPDYB2L2, SPDYE, Speedy E, Speedy Homolog E1, Speedy Homolog E1 (Xenopus Laevis), Speedy Protein E1, Speedy/RINGO Cell Cycle Regulator Family Member E1, WBSCR19, Williams Beuren Syndrome Chromosome Region 19 Protein, Williams-Beuren Syndrome Chromosomal Region 19 Protein |
|---|
| Gene, Accession # | SPDYE1, Gene ID: 285955, Accession: Q8NFV5 |
|---|
| Catalog # | NBP2-46794 |
|---|
| Price | |
|---|
| Order / More Info | SPDYE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|