| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PINX1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PINX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PINX1. This antibody reacts with human. The PINX1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PINX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP |
|---|
| Other Names | FLJ20565, hepatocellular carcinoma-related putative tumor suppressor, Liver-related putative tumor suppressor, LPTLPinX1, LPTS67-11-3 protein, MGC8850, PIN2 interacting protein 1, PIN2/TERF1 interacting, telomerase inhibitor 1, PIN2/TERF1-interacting telomerase inhibitor 1, PIN2-interacting protein 1, Pin2-interacting protein X1, Protein 67-11-3, TRF1-interacting protein 1 |
|---|
| Gene, Accession # | PINX1, Gene ID: 54984 |
|---|
| Catalog # | NBP1-83643 |
|---|
| Price | |
|---|
| Order / More Info | PINX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|