| Edit |   |
|---|
| Antigenic Specificity | C21orf58 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C21orf58 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C21orf58. This antibody reacts with human. The C21orf58 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C21orf58 (chromosome 21 open reading frame 58) The peptide sequence was selected from the N terminal of C21orf58. Peptide sequence MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW. |
|---|
| Other Names | AA82526610hypothetical protein LOC54058, chromosome 21 open reading frame 58, spliced ESTs Z25278 |
|---|
| Gene, Accession # | C21ORF58, Gene ID: 54058, Accession: P58505, SwissProt: P58505 |
|---|
| Catalog # | NBP1-70462 |
|---|
| Price | |
|---|
| Order / More Info | C21orf58 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|