| Edit |   |
|---|
| Antigenic Specificity | C20orf203 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C20orf203 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C20orf203. This antibody reacts with human. The C20orf203 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human FLJ33706. Peptide sequence RMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSR. |
|---|
| Other Names | alugen, chromosome 20 open reading frame 203, FLJ33706 |
|---|
| Gene, Accession # | C20orf203, Gene ID: 284805, Accession: NP_872390, SwissProt: NP_872390 |
|---|
| Catalog # | NBP1-91545 |
|---|
| Price | |
|---|
| Order / More Info | C20orf203 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|