| Edit |   |
|---|
| Antigenic Specificity | C20ORF141 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C20ORF141 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C20ORF141. This antibody reacts with human. The C20ORF141 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C20ORF141 The peptide sequence was selected from the middle region of C20ORF141. Peptide sequence HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG. |
|---|
| Other Names | chromosome 20 open reading frame 141, dJ860F19.4, hypothetical protein LOC128653, MGC26144 |
|---|
| Gene, Accession # | C20ORF141, Gene ID: 128653, Accession: Q9NUB4, SwissProt: Q9NUB4 |
|---|
| Catalog # | NBP1-56702 |
|---|
| Price | |
|---|
| Order / More Info | C20ORF141 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|