| Edit |   |
| Antigenic Specificity | WDR34 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR34 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR34. This antibody reacts with human. The WDR34 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to WDR34(WD repeat domain 34) The peptide sequence was selected from the C terminal of WDR34. Peptide sequence SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES. |
| Other Names | bA216B9.3, MGC20486, WD repeat domain 34, WD repeat-containing protein 34 |
| Gene, Accession # | WDR34, Gene ID: 89891, Accession: Q96EX3, SwissProt: Q96EX3 |
| Catalog # | NBP1-55268-20ul |
| Price | |
| Order / More Info | WDR34 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |