| Edit |   |
|---|
| Antigenic Specificity | WDR33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR33. This antibody reacts with human. The WDR33 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. |
|---|
| Other Names | NET14, WD repeat domain 33, WD repeat-containing protein 33, WD repeat-containing protein WDC146, WDC146FLJ11294 |
|---|
| Gene, Accession # | WDR33, Gene ID: 55339, Accession: Q6NUQ0, SwissProt: Q6NUQ0 |
|---|
| Catalog # | NBP1-60030 |
|---|
| Price | |
|---|
| Order / More Info | WDR33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|