| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SREC-I/SCARF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SREC-I/SCARF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SREC-I/SCARF1. This antibody reacts with human. The SREC-I/SCARF1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SREC-I/SCARF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI |
|---|
| Other Names | Acetyl LDL receptor, KIAA0149endothelial cells scavenger receptor, MGC47738, scavenger receptor class F, member 1, Scavenger receptor expressed by endothelial cells 1, SREC1, SREC-I, SRECscavenger receptor expressed by endothelial cells |
|---|
| Gene, Accession # | SCARF1, Gene ID: 8578 |
|---|
| Catalog # | NBP2-57396 |
|---|
| Price | |
|---|
| Order / More Info | SREC-I/SCARF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|