| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SREC-II/SCARF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SREC-II/SCARF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SREC-II/SCARF2. This antibody reacts with human, mouse, rat. The SREC-II/SCARF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SREC-II/SCARF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP |
|---|
| Other Names | HUMZD58C02, scavenger receptor class F, member 2, Scavenger receptor expressed by endothelial cells 2 protein, SREC2NSR1, SREC-IIscavenger receptor class F member 2, SRECRP-1, SREPCR |
|---|
| Gene, Accession # | SCARF2, Gene ID: 91179 |
|---|
| Catalog # | NBP1-83140 |
|---|
| Price | |
|---|
| Order / More Info | SREC-II/SCARF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|