| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SREBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SREBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SREBP2. This antibody reacts with human. The SREBP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SREBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGT |
|---|
| Other Names | BHLHD2, bHLHd2sterol regulatory element-binding protein 2, Class D basic helix-loop-helix protein 2, SREBP2, SREBP2SREBP-2, sterol regulatory element binding transcription factor 2, Sterol regulatory element-binding transcription factor 2 |
|---|
| Gene, Accession # | SREBF2, Gene ID: 6721 |
|---|
| Catalog # | NBP2-58133 |
|---|
| Price | |
|---|
| Order / More Info | SREBP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|