| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CSRP2BP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CSRP2BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CSRP2BP. This antibody reacts with human. The CSRP2BP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CSRP2BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH |
|---|
| Other Names | ADA2A-containing complex subunit 2, ATAC component 2 homolog, ATAC2CRP2BPKAT14, CRP2 binding partner, CRP2 binding protein, CRP2-binding partner, CSRP2 binding protein, CSRP2-binding protein, cysteine rich protein 2 binding protein, cysteine-rich protein 2-binding protein, dJ717M23.1, MGC15388, PRO1194 |
|---|
| Gene, Accession # | CSRP2BP, Gene ID: 57325 |
|---|
| Catalog # | NBP2-57876 |
|---|
| Price | |
|---|
| Order / More Info | CSRP2BP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|