| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CSRP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CSRP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CSRP3. This antibody reacts with human. The CSRP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CSRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGK SVYA |
|---|
| Other Names | Cardiac LIM protein, CLPMGC14488, CMD1Mcardiac LIM domain protein, CMH12, CRP3cysteine and glycine-rich protein 3, cysteine and glycine-rich protein 3 (cardiac LIM protein), Cysteine-rich protein 3, LIM domain only 4, LIM domain protein, cardiac, LMO4, MLPMGC61993, Muscle LIM protein |
|---|
| Gene, Accession # | CSRP3, Gene ID: 8048 |
|---|
| Catalog # | NBP2-13880 |
|---|
| Price | |
|---|
| Order / More Info | CSRP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|