| Edit |   |
| Antigenic Specificity | CSMD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CSMD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CSMD1. This antibody reacts with human. The CSMD1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CSMD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQAVSCGIPESPGNGSFTGNEFTLDSKVVYEC |
| Other Names | CUB and sushi domain-containing protein 1, CUB and sushi multiple domains protein 1, KIAA1890, UNQ5952/PRO19863 |
| Gene, Accession # | CSMD1, Gene ID: 64478 |
| Catalog # | NBP2-57728 |
| Price | |
| Order / More Info | CSMD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |