| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | csl/RBPJK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The csl/RBPJK Antibody from Novus Biologicals is a rabbit polyclonal antibody to csl/RBPJK. This antibody reacts with human. The csl/RBPJK Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human csl/RBPJK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS |
|---|
| Other Names | CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog |
|---|
| Gene, Accession # | RBPJ, Gene ID: 3516 |
|---|
| Catalog # | NBP2-56071 |
|---|
| Price | |
|---|
| Order / More Info | csl/RBPJK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|