| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Erbin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Erbin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Erbin. This antibody reacts with human. The Erbin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Erbin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTA YHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQR |
|---|
| Other Names | Densin-180-like protein, erbb2 interacting protein, Erbb2-interacting proteinErbin, ERBINLAP2protein LAP2, KIAA1225 |
|---|
| Gene, Accession # | ERBB2IP, Gene ID: 55914 |
|---|
| Catalog # | NBP2-13968 |
|---|
| Price | |
|---|
| Order / More Info | Erbin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28535453 |
|---|
| 产品资料 |
|
|